Gene AT3G02960.1


Sequence ID AT3G02960.1  add to my list
Species Arabidopsis thaliana
Alias Q9M8T7
Length 246aa
PubMed References
Open Display PubMed Reference(s) (4)
Accession Description
Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana.
11130713 		Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana.
Metallochaperone-like genes in Arabidopsis thaliana.
21072340 		Metallochaperone-like genes in Arabidopsis thaliana.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
27862469 		Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
23368984 		Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 246 amino acids

>AT3G02960.1_ARATH
MGKNKQNGESDNKSEKKNQKNGDSSVDKSDKKNQCKEIVLKVYMHCEGCASQVSHCLRGY
DGVEHIKTEIGDNKVVVSGKFDDPLKILRRVQKKFSRNAEMISPKHNPKQDQKEPQQKKE
SAPEIKTAILRMNMHCEGCVHEIKRGIEKIKGIQSVEPDRSKSTVVVRGVMDPPKLVEKI
KKKLGKHAELLSQITEKGKDNNKKNNNKKEESDGNKIFSYPPQYSSQHAYPSQIFSDENV
HSCSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP040674 Unannotated cluster
4 GP070448 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for AT3G02960.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cg7g016680.1 orthology 1 6 162.9 2.4e-40
Cm174370.1 orthology 1 5 176.8 2.7e-44
Cs7g11080.1 orthology 1 6 186 2.9e-47
Manes.13G008700.1 orthology 0.942 4 212.2 4.1e-55
brana_pan_p048220 orthology 0.169 2 354 3e-124
braol_pan_p002896 orthology 0.162 2 349 1.77e-122
brarr_pan_p015545 orthology 0.158 1 353 5.26e-124
orange1.1t05450.1 orthology 1 6 - -
thecc_pan_p009145 orthology 0.875 3 226 1.83e-74
thecc_pan_p020513 orthology 1 3 - -