Gene AT3G22660.1


Sequence ID AT3G22660.1  add to my list
Species Arabidopsis thaliana
Alias Q9LUJ5
Length 293aa
PubMed References
Open Display PubMed Reference(s) (4)
Accession Description
Empirical analysis of transcriptional activity in the Arabidopsis genome.
14593172 		Empirical analysis of transcriptional activity in the Arabidopsis genome.
Structural analysis of Arabidopsis thaliana chromosome 3. I. Sequence features of the regions of 4,504,864 bp covered by sixty P1 and TAC clones.
10819329 		Structural analysis of Arabidopsis thaliana chromosome 3. I. Sequence features of the regions of 4,504,864 bp covered by sixty P1 and TAC clones.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
27862469 		Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
The nucleolar GTPase nucleostemin-like 1 plays a role in plant growth and senescence by modulating ribosome biogenesis.
26163696 		The nucleolar GTPase nucleostemin-like 1 plays a role in plant growth and senescence by modulating ribosome biogenesis.



Length: 293 amino acids

>AT3G22660.1_ARATH
MSLEEDIVSDDEMNMIDEDDATDSEAESLSDSDTENEITEKLAEPTKTAIYNRDGLLDKL
QDISWPEDVDWTHKLTVEIDQGGAVDVNDDLARETAFYTQALEGTREAFGKLNEMGVNFL
RPANYYAEMVKSDVHMEKVKSRLLHEKKQIEESEERRKARDNKRMAKEVQSQKMKERAKE
KKDNIESVKKWRKQRQQSGFSDKAGEPELDFESGKSFQRGGGKKRPGVSPGDRSGGKGRP
TSRMGNKKREFRDSKFGHGGRKGLSKQNTAETTNDFKGGFRGGKASGNKRQKR




Clustering Level Family ID Family Name
1
Unknown function duf1138 family
GP002478		 Unknown function duf1138 family
2 GP018276 Unannotated cluster
3 GP042981 Unannotated cluster
4 GP075980 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Eukaryotic rRNA processing
IPR008610 		Eukaryotic rRNA processing Family

IPR008610
Figure 1: IPR domains for AT3G22660.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
PGSC0003DMP400055292 orthology 0.605 5 - -
PGSC0003DMP400055391 orthology 0.589 5 219.9 2.2e-57
Solyc01g006090.2.1 orthology 0.602 5 224.9 6.8e-59
Solyc01g006170.2.1 orthology 0.587 4 - -
brana_pan_p006433 orthology 0.143 2 - -
brana_pan_p007884 orthology 0.141 3 415 3.6e-147
brana_pan_p012403 orthology 0.136 2 - -
brana_pan_p034179 orthology 0.124 2 - -
braol_pan_p022657 orthology 0.122 2 410 2.7e-145
braol_pan_p024061 orthology 0.183 3 - -
braol_pan_p030426 orthology 0.143 2 - -
brarr_pan_p009571 orthology 0.124 2 - -
brarr_pan_p026538 orthology 0.131 1 431 8.03e-154
brarr_pan_p031703 orthology 0.13 2 - -
capan_pan_p017109 orthology 0.684 4 161 3.32e-48
ipotf_pan_p017885 orthology 0.59 4 205 8.44e-65
ipotf_pan_p024335 orthology 0.865 3 - -
ipotf_pan_p027028 orthology 0.633 3 - -
itb11g17740.t1 orthology 0.583 3 - -
itb12g07110.t1 orthology 0.588 4 188.7 5.9e-48