Gene AT3G25855.1


Sequence ID AT3G25855.1  add to my list
Species Arabidopsis thaliana
Alias Q8LBL7
Length 112aa
PubMed References
Open Display PubMed Reference(s) (3)
Accession Description
Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana.
11130713 		Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana.
Full-length messenger RNA sequences greatly improve genome annotation.
12093376 		Full-length messenger RNA sequences greatly improve genome annotation.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
27862469 		Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 112 amino acids

>AT3G25855.1_ARATH
MSEKKQCCVVMRINLDCNACCRKARRIIINMKEVDTHMINKKERQVILCGRFRPSDVALK
LQRKMKRRVEILEVEDLTNGHGGEEGSEHELPYEQPHEYSNQPDQMTTPLLC




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP109350 Unannotated cluster
3 GP119142 Unannotated cluster
4 GP077996 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR036163
Figure 1: IPR domains for AT3G25855.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cg7g014560.1 orthology 0.992 5 105.1 2.7e-23
Cm038010.1 orthology 0.993 6 105.1 4.5e-23
Cs7g13150.1 orthology 0.993 6 105.1 2.9e-23
FvH4_4g27630.1 orthology 1 4 103.2 1.1e-22
Manes.06G070100.1 orthology 0.854 2 - -
Manes.14G100500.1 orthology 0.776 2 118.2 3.7e-27
brana_pan_p048851 orthology 0.261 3 160 1.74e-52
braol_pan_p038631 orthology 0.283 2 - -
brarr_pan_p017699 orthology 0.279 3 158 1.63e-51
maldo_pan_p037558 orthology 1 4 - -
maldo_pan_p044634 orthology 1 4 - -
maldo_pan_p046030 orthology 1 4 - -
maldo_pan_p049521 orthology 1 4 - -
maldo_pan_p049537 orthology 1 4 108 8.6e-32
maldo_pan_p055366 orthology 1 4 - -