Gene AT3G56891.1


Sequence ID AT3G56891.1  add to my list
Species Arabidopsis thaliana
Alias B3H6D0
Length 166aa
PubMed References
Open Display PubMed Reference(s) (4)
Accession Description
Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana.
11130713 		Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana.
Metallochaperone-like genes in Arabidopsis thaliana.
21072340 		Metallochaperone-like genes in Arabidopsis thaliana.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
27862469 		Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
23368984 		Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 166 amino acids

>AT3G56891.1_ARATH
MFDWIHGNSRLPIALSIVELLVDMDCKGCEKKVRRAISKLDGVDTVEIDVDRQKVTVTGY
VDREEVLKMVKRTGRTAEYWPFPYNGYYGDYYTYPSQHLEQSDQKIYQTISYSGKYDFYD
VDDFQNTNNSTINGYYPSSSQKVQPNIDENALHLFSDDNAHACTIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily
Heavy-metal-associated, conserved site
IPR017969 		Heavy-metal-associated, conserved site Conserved_site

IPR006121 IPR036163 IPR017969
Figure 1: IPR domains for AT3G56891.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_28_123.1 orthology 0.97 6 - -
Ca_31_155.3 orthology 0.926 6 - -
Ca_64_676.1 orthology 0.886 6 - -
Ca_78_1273.1 orthology 0.926 6 - -
Cc06_g21060 orthology 0.841 6 - -
Cg6g011520.1 orthology 0.758 8 164.5 5.5e-41
Cs6g10930.1 orthology 0.752 8 158.3 4.3e-39
DCAR_016949 orthology 0.986 6 - -
FvH4_2g26780.1 orthology 0.759 6 132.1 3.2e-31
MELO3C019416.2.1 orthology 0.837 8 109.8 1.5e-24
Manes.08G099200.1 orthology 0.706 4 134 9.6e-32
Oeu053981.1 orthology 0.907 7 102.4 4.2e-22
brana_pan_p032952 orthology 0.24 2 - -
brana_pan_p033418 orthology 0.211 3 253 2.58e-87
brana_pan_p049288 orthology 0.239 1 - -
braol_pan_p001934 orthology 0.245 2 - -
braol_pan_p038031 orthology 0.188 2 253 1.16e-87
brarr_pan_p006813 orthology 0.211 3 252 2.96e-87
brarr_pan_p018750 orthology 0.244 1 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_46944.1 orthology 0.894 10 118.2 5.4e-27
cucsa_pan_p011351 orthology 0.87 8 127 3.99e-38
ipotf_pan_p003030 orthology 1 8 139 5.38e-43
itb11g01700.t1 orthology 1 8 138.7 4e-33
maldo_pan_p024328 orthology 0.843 6 - -
maldo_pan_p038662 orthology 0.749 6 132 6.27e-40
medtr_pan_p030129 orthology 0.846 8 104 1.16e-29
phavu.G19833.gnm2.ann1.Phvul.004G052700.1 orthology 0.893 9 147.5 7.5e-36
soybn_pan_p020075 orthology 0.911 10 - -
thecc_pan_p019791 orthology 0.711 7 139 6.73e-43
vitvi_pan_p003255 orthology 0.698 4 135 1.83e-41