Gene AT4G10465.1


Sequence ID AT4G10465.1  add to my list
Species Arabidopsis thaliana
Alias F4JMB8
Length 183aa
PubMed References
Open Display PubMed Reference(s) (5)
Accession Description
Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana.
10617198 		Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana.
Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
17147637 		Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
Metallochaperone-like genes in Arabidopsis thaliana.
21072340 		Metallochaperone-like genes in Arabidopsis thaliana.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
27862469 		Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
23368984 		Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 183 amino acids

>AT4G10465.1_ARATH
MSSLIVKSLGSIVSIIARIFFFRRSRPVSNPRTTAHISYFRMSRKRPLSLQTVELKVRMC
CTGCVRIVRNAISKLRGVDSVEVDKELGRVRVVGYVDRNKVLKAVRRAGKRAEFSPYPEP
PLYFTSTQNYFVDPSKEFKESYNYYRHGYNGTEQHGNIPVGSRGDDRVSNMFNDDNVNAC
RLM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for AT4G10465.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
brana_pan_p034390 orthology 0.103 3 325 3.7e-115
brana_pan_p059795 orthology 0.235 1 - -
braol_pan_p039816 orthology 0.103 3 325 3.35e-115
brarr_pan_p039064 orthology 0.107 2 323 1.22e-114