Gene AT5G50740.3
Sequence ID | AT5G50740.3 add to my list | ||
---|---|---|---|
Species | Arabidopsis thaliana | ||
Alias | Q570V5 | ||
Length | 290aa | ||
Gene Ontology |
![]()
|
Length: 290 amino acids
>AT5G50740.3_ARATH MGEEDKKMEEKKSEEPQAKSEDKKPEEEKKKEPQEIVLKIFMHCEGCAKKIHRCLKGFEG VEDVTTDCKTSKVVVKGEKADPLKVLQRLQRKSHRQVELISPIPEPKPVSDEPEKKEKEK PKPEEKKEEVVTVVLRVHMHCEACAMEIQKRIMRMKGVESVEPDFKASQVSVKGVFTPEK LVEFIYKRIGKHAAVVKQDPPPKPPEKEKETKDKDEKKKEEGQPKEGKEAKENGGGGGAK GDGAAAEEGNKVVDLKKNEYQYQPPRYPVEMFAYPPQIFSDENPNACTII
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for AT5G50740.3
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
MELO3C002372.2.1 | orthology | 0.465 | 3 | 249 | 1.17e-81 |
brana_pan_p008102 | orthology | 0.0993 | 3 | 329 | 1.73e-113 |
braol_pan_p032028 | orthology | 0.0993 | 3 | 320 | 7.32e-110 |
brarr_pan_p007939 | orthology | 0.108 | 2 | 308 | 7.18e-106 |
cucsa_pan_p017723 | orthology | 0.466 | 3 | 250 | 2.74e-82 |