Gene AT5G65980.1


Sequence ID AT5G65980.1  add to my list
Species Arabidopsis thaliana
Alias Q9FKY4
Length 395aa
PubMed References
Open Display PubMed Reference(s) (4)
Accession Description
Structural analysis of Arabidopsis thaliana chromosome 5. V. Sequence features of the regions of 1,381,565 bp covered by twenty one physically assigned P1 and TAC clones.
9679202 		Structural analysis of Arabidopsis thaliana chromosome 5. V. Sequence features of the regions of 1,381,565 bp covered by twenty one physically assigned P1 and TAC clones.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
27862469 		Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
A novel putative auxin carrier family regulates intracellular auxin homeostasis in plants.
22504182 		A novel putative auxin carrier family regulates intracellular auxin homeostasis in plants.
Evolution and structural diversification of PILS putative auxin carriers in plants.
23091477 		Evolution and structural diversification of PILS putative auxin carriers in plants.



Length: 395 amino acids

>AT5G65980.1_ARATH
MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL
AETVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM
LILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFYIWTYSYQLVRSSATQFRALEA
AGLVKSPNKDIDSDPHALLLKPHQNQDLEIQGKQKVSTRTYIKDLLHQILEELFAPPTIG
AILGFVFGATNWLRNLIIGENAPLRVIQDSVKLLGEGTIPCITLILGGNLIQGLRSSAVK
KSVIVGVIIVRYILLPVVGVGVVQLAGNLGYLPPDPLFRYVLMLQFALPPAMNISTMAQL
FDVAQDECSVIFLWTYLVASLALTVWSTIFLSILS




Clustering Level Family ID Family Name
1
Auxin efflux carrier family
GP000355		 Auxin efflux carrier family
2 GP015273 Unannotated cluster
3 GP040583 Unannotated cluster
4 GP463648 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Membrane transport protein
IPR004776 		Membrane transport protein Family

IPR004776
Figure 1: IPR domains for AT5G65980.1