Gene AUR62010447-RA
| Sequence ID | AUR62010447-RA add to my list |
|---|---|
| Species | Chenopodium quinoa |
| Alias | No gene alias |
| Length | 167aa |
Length: 167 amino acids
>AUR62010447-RA_CHEQI CSSSNIIIDDDDVHNKSGRRSFSKPSDLILKAAACANTKPGVDYISPPESSRYLLDDTSF LEVLSDFDPVLKLKPYDTCNHNNVEVVKSEAGSKPPKPPSSTGLSDQVVVLRVSLHCRGC ERKMKKHLSRMPVDECSSSQDIYVVDNGRGIGNSLKVPNIQELKVAS
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AUR62030468-RA | ultra-paralogy | 0.199 | 0 | - | - |
| Bv5_103030_anmg.t1 | orthology | 0.341 | 1 | - | - |
| PGSC0003DMP400030742 | orthology | 0.948 | 5 | - | - |
| Solyc10g085910.1.1 | orthology | 0.955 | 5 | - | - |
| capan_pan_p021656 | orthology | 0.922 | 4 | - | - |
| ipotf_pan_p006474 | orthology | 0.761 | 3 | - | - |
| itb09g27700.t1 | orthology | 0.758 | 3 | - | - |