Gene AUR62015981-RA
| Sequence ID | AUR62015981-RA add to my list | ||
|---|---|---|---|
| Species | Chenopodium quinoa | ||
| Alias | No gene alias | ||
| Length | 229aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 229 amino acids
>AUR62015981-RA_CHEQI MGRQPESQHQGLTQFEQRRHSLGVPPAAWISDWETVVGRVGSALGILGWAECMEEAGEEC AGGVEIEEECGVGLCGEGLGLDMWGWVEGVESATSMVEVLVPNLDCEGCASKLKKALYKL KGVEDIEVEMDTQKVTVKGYRLEERKVIKAIKRAGKAAEPWPFPSHSHYASFYKYPSYIT NHYYDTSNGAAPSVHAFFHTPSVYSVAVASDEAVASIFSDDNPHACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for AUR62015981-RA
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G48970.1 | orthology | 0.587 | 6 | - | - |
| Bv3_055490_mxet.t1 | orthology | 0.0625 | 1 | 258.8 | 2.9e-69 |
| Ca_8_1007.1 | orthology | 0.467 | 8 | - | - |
| Cc02_g02970 | orthology | 0.467 | 8 | 212.6 | 2.3e-55 |
| Cg9g026790.1 | orthology | 0.387 | 6 | 220.7 | 9e-58 |
| Cm028340.1 | orthology | 0.387 | 6 | 220.7 | 1.5e-57 |
| Cs9g17280.1 | orthology | 0.387 | 6 | 220.7 | 9.8e-58 |
| DCAR_009368 | orthology | 0.546 | 10 | - | - |
| FvH4_7g29520.1 | orthology | 0.426 | 7 | - | - |
| HanXRQChr06g0183831 | orthology | 0.548 | 5 | 205.7 | 5e-53 |
| HanXRQChr09g0253621 | orthology | 0.576 | 5 | - | - |
| MELO3C003319.2.1 | orthology | 0.381 | 3 | - | - |
| Manes.14G025900.1 | orthology | 0.459 | 7 | 214.9 | 5.9e-56 |
| Mba01_g04690.1 | orthology | 0.795 | 10 | 171 | 1.45e-54 |
| Oeu024220.1 | orthology | 0.442 | 7 | 219.9 | 2.5e-57 |
| PGSC0003DMP400025270 | orthology | 0.46 | 10 | 219.2 | 2.9e-57 |
| Solyc03g025790.2.1 | orthology | 0.45 | 10 | 218 | 6.5e-57 |
| brana_pan_p044950 | orthology | 0.56 | 7 | 205 | 7.77e-68 |
| braol_pan_p025375 | orthology | 0.56 | 8 | - | - |
| brarr_pan_p005835 | orthology | 0.56 | 8 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_41314.1 | orthology | 0.436 | 8 | 223.4 | 1.6e-58 |
| capan_pan_p012989 | orthology | 0.472 | 9 | 219 | 1.65e-73 |
| cucsa_pan_p007884 | orthology | 0.348 | 3 | - | - |
| evm_27.model.AmTr_v1.0_scaffold00076.26 | orthology | 0.759 | 8 | - | - |
| ipotf_pan_p019855 | orthology | 0.472 | 9 | - | - |
| ipotf_pan_p021461 | orthology | 0.643 | 9 | - | - |
| itb03g13280.t1 | orthology | 0.472 | 9 | - | - |
| itb12g25750.t1 | orthology | 0.63 | 9 | - | - |
| maldo_pan_p005834 | orthology | 0.432 | 7 | - | - |
| maldo_pan_p046866 | orthology | 0.857 | 7 | - | - |
| medtr_pan_p031372 | orthology | 0.419 | 6 | 219 | 1.29e-73 |
| musac_pan_p029616 | orthology | 0.781 | 10 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.004G116300.1 | orthology | 0.434 | 8 | 218.8 | 3.7e-57 |
| soybn_pan_p030070 | orthology | 0.41 | 7 | 192 | 6.66e-63 |
| thecc_pan_p002573 | orthology | 0.407 | 7 | 224 | 1.41e-75 |
| vitvi_pan_p028565 | orthology | 0.385 | 4 | 215 | 4.86e-72 |