Gene AUR62022341-RA
Sequence ID | AUR62022341-RA add to my list | ||
---|---|---|---|
Species | Chenopodium quinoa | ||
Alias | No gene alias | ||
Length | 144aa | ||
Gene Ontology |
![]()
|
Length: 144 amino acids
>AUR62022341-RA_CHEQI MGVQGTLDYLSDLISSAKKGKKRKQLNTVNLKVTRIDCEGCAMKMKKALSGVKSVDVDMK QQKVTVTGFVEAKKVLKAAKSTKKKIELWPYVPYNMVPHPYIAGAYDKKAPANFVRKVED SMTPLEEQYTTMFSDENPDACTIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for AUR62022341-RA
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AUR62034366-RA | ultra-paralogy | 0.0298 | 0 | - | - |
Bv1_021330_sfoa.t1 | orthology | 0.149 | 1 | - | - |