Gene AUR62022965-RA
Sequence ID | AUR62022965-RA add to my list | ||
---|---|---|---|
Species | Chenopodium quinoa | ||
Alias | No gene alias | ||
Length | 91aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 91 amino acids
>AUR62022965-RA_CHEQI MPHLRLHSHAYMQMVELKVGLHCDECIKKILKAIKKIEDIETYNIDTRLNKVTVTGNVTE EEVIRVIHKIGKTASSWDDREESINVSAGYM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP240412 | Unannotated cluster |
3 | GP342479 | Unannotated cluster |
4 | GP464531 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for AUR62022965-RA
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Bv2_044470_umgd.t1 | orthology | 0.276 | 1 | 134.8 | 2.5e-32 |
maldo_pan_p020043 | orthology | 0.482 | 3 | 117 | 2.54e-36 |
thecc_pan_p001547 | orthology | 0.652 | 4 | 112 | 1.92e-34 |
vitvi_pan_p021528 | orthology | 0.537 | 5 | 115 | 1.29e-35 |
vitvi_pan_p026180 | orthology | 0.537 | 4 | - | - |
vitvi_pan_p042470 | orthology | 0.537 | 5 | - | - |