Gene AUR62022965-RA


Sequence ID AUR62022965-RA  add to my list
Species Chenopodium quinoa
Alias No gene alias
Length 91aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 91 amino acids

>AUR62022965-RA_CHEQI
MPHLRLHSHAYMQMVELKVGLHCDECIKKILKAIKKIEDIETYNIDTRLNKVTVTGNVTE
EEVIRVIHKIGKTASSWDDREESINVSAGYM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP240412 Unannotated cluster
3 GP342479 Unannotated cluster
4 GP464531 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for AUR62022965-RA



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Bv2_044470_umgd.t1 orthology 0.276 1 134.8 2.5e-32
maldo_pan_p020043 orthology 0.482 3 117 2.54e-36
thecc_pan_p001547 orthology 0.652 4 112 1.92e-34
vitvi_pan_p021528 orthology 0.537 5 115 1.29e-35
vitvi_pan_p026180 orthology 0.537 4 - -
vitvi_pan_p042470 orthology 0.537 5 - -