Gene AUR62023334-RA
| Sequence ID | AUR62023334-RA add to my list | ||
|---|---|---|---|
| Species | Chenopodium quinoa | ||
| Alias | No gene alias | ||
| Length | 229aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 229 amino acids
>AUR62023334-RA_CHEQI MAKGGVSAAFYKLNLHCPECAHKIRSPLLKIQGVRAVDVNFEKSEVKVVGAFDSKKIHQK LERLSKRKVEVLKVEENYKHTVVVEKVVKETKEVAVFTHTVRVHLHCEQCEADLRRKLLR HKGIYNVKSDMKAQTLAVEGTIESEKLVKHIRSKFHKHAELVTAKEIKKEEKKEEIKKVE ETKTTKKVIDVEEVKDVQEKLKASNTPYIIHYVYAPQWFSDEDPNACSI
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP342504 | Unannotated cluster |
| 4 | GP464372 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for AUR62023334-RA
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AUR62037999-RA | ultra-paralogy | 0.06 | 0 | - | - |
| Bv1_016920_ytts.t1 | orthology | 0.175 | 1 | 314.7 | 4.4e-86 |
| vitvi_pan_p029858 | orthology | 0.774 | 2 | 205 | 1.02e-66 |