Gene AUR62024872-RA
| Sequence ID | AUR62024872-RA add to my list | ||
|---|---|---|---|
| Species | Chenopodium quinoa | ||
| Alias | No gene alias | ||
| Length | 160aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 160 amino acids
>AUR62024872-RA_CHEQI MGFLNHILDFFDASIPRHKKRKPMQTVEIKVKMDCDGCERRVRNSVIHIKGVKSVDVNRK LSKVTVTGNVEPNRVLNKVKRTGKRAEFWPYVPYTMVAYPYAAQAYDKKAPSGYVKNAPQ AYAGNNNDGPHEKYTQLFSDDNPNASCNINLSINHLSWVT
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for AUR62024872-RA
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AUR62030676-RA | ultra-paralogy | 0.0294 | 0 | - | - |
| Bv6_142690_rfcx.t1 | orthology | 0.463 | 1 | - | - |
| Ca_9_830.1 | orthology | 0.686 | 5 | - | - |
| Cc11_g08870 | orthology | 0.686 | 5 | - | - |
| DCAR_007285 | orthology | 0.633 | 5 | - | - |
| DCAR_023613 | orthology | 0.678 | 5 | - | - |
| DCAR_026769 | orthology | 0.648 | 5 | - | - |
| HanXRQChr08g0212651 | orthology | 0.632 | 3 | - | - |
| Oeu036720.1 | orthology | 0.6 | 3 | - | - |
| Oeu044351.1 | orthology | 0.582 | 3 | - | - |
| PGSC0003DMP400010633 | orthology | 0.66 | 6 | - | - |
| Solyc04g007630.1.1 | orthology | 0.653 | 6 | - | - |
| capan_pan_p011898 | orthology | 0.66 | 5 | - | - |
| capan_pan_p025493 | orthology | 0.601 | 5 | - | - |
| capan_pan_p030603 | orthology | 0.669 | 5 | - | - |
| ipotf_pan_p001332 | orthology | 0.881 | 5 | - | - |
| ipotf_pan_p026205 | orthology | 0.886 | 5 | - | - |
| ipotf_pan_p028506 | orthology | 0.742 | 5 | - | - |
| itb04g14310.t1 | orthology | 0.859 | 5 | - | - |
| itb07g07120.t1 | orthology | 0.735 | 5 | - | - |
| itb14g01060.t2 | orthology | 0.886 | 5 | - | - |