Gene AUR62038214-RA
Sequence ID | AUR62038214-RA add to my list | ||
---|---|---|---|
Species | Chenopodium quinoa | ||
Alias | No gene alias | ||
Length | 140aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 140 amino acids
>AUR62038214-RA_CHEQI MSKEEFLKIQTCVLKVNIHCDGCKQKVKKILQKIEGVYKTSIDAEQGKVTVSGNVDPTTL IKKLNKSGKHAELWGAPKPNNNNNQNQLKNVDNGAAEPATVAANAATTAAAIAATDEGTW NGWRSENATAISRNEDAVER
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for AUR62038214-RA
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Bv_008030_qwhu.t1 | orthology | 1 | 2 | - | - |
Mba10_g00630.1 | orthology | 0.881 | 2 | 129.4 | 2e-30 |
XP_008797065.1 | orthology | 0.757 | 2 | - | - |