Gene AUR62038214-RA
| Sequence ID | AUR62038214-RA add to my list | ||
|---|---|---|---|
| Species | Chenopodium quinoa | ||
| Alias | No gene alias | ||
| Length | 140aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 140 amino acids
>AUR62038214-RA_CHEQI MSKEEFLKIQTCVLKVNIHCDGCKQKVKKILQKIEGVYKTSIDAEQGKVTVSGNVDPTTL IKKLNKSGKHAELWGAPKPNNNNNQNQLKNVDNGAAEPATVAANAATTAAAIAATDEGTW NGWRSENATAISRNEDAVER
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for AUR62038214-RA
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Bv_008030_qwhu.t1 | orthology | 1 | 2 | - | - |
| Mba10_g00630.1 | orthology | 0.881 | 2 | 129.4 | 2e-30 |
| XP_008797065.1 | orthology | 0.757 | 2 | - | - |