Gene Bv1_016920_ytts.t1
Sequence ID | Bv1_016920_ytts.t1 add to my list | ||
---|---|---|---|
Species | Beta vulgaris | ||
Alias | No gene alias | ||
Length | 232aa | ||
Gene Annotation | cDNAEvidence=100 | ||
Gene Ontology |
Display term(s) (1)
|
Length: 232 amino acids
>Bv1_016920_ytts.t1_BETVU MAKEGVSAAFYKLNLHCPECANKIKSPLLKIQGVRNVDVNFAKSEVKVIGVIDSKKIHQR IEKISKRKVELLKVEANYKHTVVVEKVVKETKEATVFTHKVKAHLHCDQCEADLRRKLLR HKAIYNVKSDMKAQTMLIEGSIEGDKLVKHIREKFHKHAEIVSAKEVKKEVKNEKGEIKK VEETKNTKKVIDVEEVKDVKEKLKETNTPYIIHYVYAPQWFSDEDPNACYVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP342504 | Unannotated cluster |
4 | GP464372 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Bv1_016920_ytts.t1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AUR62023334-RA | orthology | 0.175 | 1 | 314.7 | 8.2e-86 |
AUR62037999-RA | orthology | 0.212 | 1 | - | - |
vitvi_pan_p029858 | orthology | 0.803 | 2 | 195 | 9.65e-63 |