Gene Bv2_027600_garc.t1
| Sequence ID | Bv2_027600_garc.t1 add to my list | ||
|---|---|---|---|
| Species | Beta vulgaris | ||
| Alias | No gene alias | ||
| Length | 147aa | ||
| Gene Annotation | cDNAEvidence=100 | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 147 amino acids
>Bv2_027600_garc.t1_BETVU MGALDYFADFCTVTSTRTRRKPLQTVEIKVKMDCDGCERRVKNAVTNLKGVKSVEISRKQ SKVTVTGHVDPNKVLNKVKNTGKKRAEFWPYIEHNLVAYPYIAGAYDKRAPAGYCKDVPQ AYPTYSVPQENMSSLFSDDNPNACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Bv2_027600_garc.t1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AUR62023200-RA | orthology | 0.207 | 1 | 217.6 | 8.6e-57 |