Gene Bv3_055490_mxet.t1
| Sequence ID | Bv3_055490_mxet.t1 add to my list | ||
|---|---|---|---|
| Species | Beta vulgaris | ||
| Alias | No gene alias | ||
| Length | 134aa | ||
| Gene Annotation | cDNAEvidence=85.7 | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 134 amino acids
>Bv3_055490_mxet.t1_BETVU MVEVLVPNLDCEGCASKLKKALYKLKGVEDIEVDMDAQKVTVKGYRLEERKVIKAIKRAG KAAEPWPFPSHSHYASFYKYPSYIANHYYDTSDGSAPSVHAFFHTPAVYSVAVASDDAVA SMFSDDNPHACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Bv3_055490_mxet.t1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G48970.1 | orthology | 0.62 | 6 | 193.7 | 7.1e-50 |
| AUR62015981-RA | orthology | 0.0625 | 1 | 258.8 | 3.1e-69 |
| Ca_8_1007.1 | orthology | 0.5 | 8 | 206.5 | 2.9e-53 |
| Cc02_g02970 | orthology | 0.5 | 8 | 206.5 | 9.8e-54 |
| Cg9g026790.1 | orthology | 0.419 | 6 | 217.6 | 4.4e-57 |
| Cm028340.1 | orthology | 0.419 | 6 | 217.6 | 7.5e-57 |
| Cs9g17280.1 | orthology | 0.419 | 6 | 217.6 | 4.8e-57 |
| DCAR_009368 | orthology | 0.579 | 10 | 208.8 | 2.4e-54 |
| FvH4_7g29520.1 | orthology | 0.459 | 7 | 211.5 | 3.3e-55 |
| HanXRQChr06g0183831 | orthology | 0.582 | 5 | - | - |
| HanXRQChr09g0253621 | orthology | 0.609 | 5 | 204.5 | 6.5e-53 |
| MELO3C003319.2.1 | orthology | 0.414 | 3 | 186.4 | 9.9e-48 |
| Manes.14G025900.1 | orthology | 0.492 | 7 | 210.7 | 6.5e-55 |
| Mba01_g04690.1 | orthology | 0.828 | 10 | 172.6 | 1.9e-43 |
| Oeu024220.1 | orthology | 0.474 | 7 | 216.5 | 1.6e-56 |
| PGSC0003DMP400025270 | orthology | 0.493 | 10 | 213 | 1.2e-55 |
| Solyc03g025790.2.1 | orthology | 0.483 | 10 | 211.8 | 2.7e-55 |
| brana_pan_p044950 | orthology | 0.593 | 7 | 204 | 8.28e-69 |
| braol_pan_p025375 | orthology | 0.593 | 8 | 204 | 8.01e-69 |
| brarr_pan_p005835 | orthology | 0.593 | 8 | 204 | 7.14e-69 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_41314.1 | orthology | 0.469 | 8 | 223.8 | 7.3e-59 |
| capan_pan_p012989 | orthology | 0.505 | 9 | 216 | 6.87e-74 |
| cucsa_pan_p007884 | orthology | 0.381 | 3 | 196 | 1.69e-65 |
| evm_27.model.AmTr_v1.0_scaffold00076.26 | orthology | 0.792 | 8 | 184.1 | 4.3e-47 |
| ipotf_pan_p019855 | orthology | 0.505 | 9 | 206 | 8.74e-70 |
| ipotf_pan_p021461 | orthology | 0.676 | 9 | - | - |
| itb03g13280.t1 | orthology | 0.505 | 9 | 203.8 | 8.1e-53 |
| itb12g25750.t1 | orthology | 0.663 | 9 | - | - |
| maldo_pan_p005834 | orthology | 0.465 | 7 | 216 | 9.13e-74 |
| maldo_pan_p046866 | orthology | 0.89 | 7 | - | - |
| medtr_pan_p031372 | orthology | 0.452 | 6 | 218 | 1.87e-74 |
| musac_pan_p029616 | orthology | 0.814 | 10 | 176 | 7.13e-58 |
| phavu.G19833.gnm2.ann1.Phvul.004G116300.1 | orthology | 0.467 | 8 | 216.5 | 1.1e-56 |
| soybn_pan_p030070 | orthology | 0.443 | 7 | 192 | 1.29e-64 |
| thecc_pan_p002573 | orthology | 0.44 | 7 | 220 | 1.17e-75 |
| vitvi_pan_p028565 | orthology | 0.418 | 4 | 212 | 2.91e-72 |