Gene Bv4_095130_difj.t1


Sequence ID Bv4_095130_difj.t1  add to my list
Species Beta vulgaris
Alias No gene alias
Length 120aa
Gene Annotation cDNAEvidence=100
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 120 amino acids

>Bv4_095130_difj.t1_BETVU
MSQTVVLNVAMTCKGCSGAVKRVLDKMEGVESYDINLEEKKVTVTGNITPEAVLQTVSKT
GKKTSYWEEAAPAPAPAPAEVEAELGEAKAEPVEAGAKPAEDEAKPAEAETKPAEAVAAP




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily
Heavy-metal-associated, conserved site
IPR017969 		Heavy-metal-associated, conserved site Conserved_site

IPR006121 IPR036163 IPR017969
Figure 1: IPR domains for Bv4_095130_difj.t1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AUR62034495-RA orthology 0.308 1 - -
AUR62035482-RA orthology 0.342 1 118.6 4.4e-27