Gene Bv5_110870_wcqq.t1
| Sequence ID | Bv5_110870_wcqq.t1 add to my list | ||
|---|---|---|---|
| Species | Beta vulgaris | ||
| Alias | No gene alias | ||
| Length | 97aa | ||
| Gene Annotation | cDNAEvidence=100 | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 97 amino acids
>Bv5_110870_wcqq.t1_BETVU MKEKYFCMILRIKIDCNGCYRKVKEALLNIRELESHIIEKRSSRVIVFGIFTPQDVAIKI RKKTNRRVEILEIQQLSPNYPENYQDQGYLMIATNDK
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Bv5_110870_wcqq.t1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Bv5_110870_wcqq.t2 | ultra-paralogy | 0.001 | 0 | - | - |
| CgUng002450.1 | orthology | 1 | 8 | 109.8 | 9.4e-25 |
| Cm118330.1 | orthology | 1 | 7 | 107.5 | 7.9e-24 |
| Cs7g26570.1 | orthology | 1 | 8 | 109.8 | 1e-24 |
| FvH4_5g12320.1 | orthology | 1 | 7 | 117.1 | 6.2e-27 |
| Manes.05G138100.1 | orthology | 0.879 | 6 | 96.3 | 1.3e-20 |
| PGSC0003DMP400010112 | orthology | 1 | 8 | 105.1 | 2.6e-23 |
| Solyc03g119630.2.1 | orthology | 1 | 9 | 109.4 | 1.4e-24 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_35493.1 | orthology | 1 | 7 | 106.3 | 1.2e-23 |
| capan_pan_p000343 | orthology | 1 | 9 | - | - |
| cicar_pan_p024669 | orthology | 1 | 8 | - | - |
| cucsa_pan_p010693 | orthology | 0.614 | 1 | 119 | 1.59e-36 |
| maldo_pan_p026714 | orthology | 1 | 7 | - | - |
| medtr_pan_p036900 | orthology | 1 | 8 | 127 | 2.38e-39 |
| phavu.G19833.gnm2.ann1.Phvul.004G158700.1 | orthology | 1 | 7 | 111.7 | 2.7e-25 |
| soybn_pan_p040036 | orthology | 1 | 7 | - | - |
| soybn_pan_p040183 | orthology | 1 | 7 | 120 | 8.84e-37 |
| soybn_pan_p040952 | orthology | 1 | 7 | - | - |
| soybn_pan_p042566 | orthology | 1 | 7 | - | - |
| thecc_pan_p001600 | orthology | 0.729 | 2 | 112 | 2.86e-33 |
| vitvi_pan_p014384 | orthology | 0.739 | 3 | 117 | 1.68e-34 |