Gene Bv6_135550_hnzj.t1
| Sequence ID | Bv6_135550_hnzj.t1 add to my list | ||
|---|---|---|---|
| Species | Beta vulgaris | ||
| Alias | No gene alias | ||
| Length | 155aa | ||
| Gene Annotation | cDNAEvidence=80 | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 155 amino acids
>Bv6_135550_hnzj.t1_BETVU MGVGGTLEYFSEMMGGGHMHKKKRKQFQTVELKVRMDCDGCELKVKKALSSLSGVKSVEI NRKQQKVTVSGYVEANKVLKKAKATGKKAEIWPYVPYNLVSQPYATAAYDKKAPPGHVRK VDFMENPKTATVTQYDQDPLVSMFSDDNPNACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Bv6_135550_hnzj.t1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT4G39700.1 | orthology | 0.428 | 4 | 228.4 | 3e-60 |
| AUR62002038-RA | orthology | 0.0957 | 1 | - | - |
| AUR62003759-RA | orthology | 0.0765 | 1 | 297.7 | 6.9e-81 |
| PGSC0003DMP400038108 | orthology | 0.316 | 4 | - | - |
| Solyc04g054500.2.1 | orthology | 0.285 | 4 | 234.2 | 5.9e-62 |
| brana_pan_p027029 | orthology | 0.374 | 6 | 228 | 9.36e-78 |
| braol_pan_p025817 | orthology | 0.38 | 5 | 224 | 2.83e-76 |
| brarr_pan_p028146 | orthology | 0.374 | 6 | 228 | 7.56e-78 |