Gene Ca_23_68.6
| Sequence ID | Ca_23_68.6 add to my list | ||
|---|---|---|---|
| Species | Coffea arabica | ||
| Alias | No gene alias | ||
| Length | 178aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 178 amino acids
>Ca_23_68.6_COFAR MMKMNMKAAKNMRGFMCQSPAATAVCMASEPLSVIVRRGPESDRTLAEHARLIDSTKHSR MVEPRARSRGLASATLRSAIVPSFGVENQPEKASRSQVVSSLAERDQVFQVVVMRVSLHC QGCAGKVKKHLSKMEGVTSFSIDLESKRVTVMGHVSPTGVVESISKVKRAELWPSAPC
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Ca_23_68.6
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cg3g006140.1 | orthology | 0.678 | 7 | 142.5 | 2.4e-34 |
| Cm169730.1 | orthology | 0.674 | 7 | - | - |
| Cm169730.2.1 | orthology | 0.674 | 7 | 147.1 | 1.7e-35 |
| HanXRQChr11g0336891 | orthology | 0.64 | 2 | 161 | 1.1e-39 |
| MELO3C018661.2.1 | orthology | 0.572 | 3 | 155.2 | 3.3e-38 |
| Manes.06G009700.1 | orthology | 0.673 | 4 | 165.2 | 4.2e-41 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_13580.1 | orthology | 0.855 | 2 | - | - |
| cucsa_pan_p000289 | orthology | 0.607 | 3 | - | - |
| orange1.1t02697.1 | orthology | 0.678 | 7 | 147.1 | 1.1e-35 |
| thecc_pan_p016597 | orthology | 0.578 | 5 | - | - |