Gene Ca_27_985.2
| Sequence ID | Ca_27_985.2 add to my list |
|---|---|
| Species | Coffea arabica |
| Alias | No gene alias |
| Length | 140aa |
Length: 140 amino acids
>Ca_27_985.2_COFAR MAKGKNKDEDDQNIKFQCIAMHAKEVLQKPFPKSKIFACIDLEGVETFMTDMPRQRVVVK GRINPEKVVQKIKKKTGKRVKILINEEGDDTHSDKEDGASALQETSEQLQIQQPLVLDSC WDSEIYTMFSDENPNACSTM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP343847 | Unannotated cluster |
| 4 | GP466810 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Figure 1: IPR domains for Ca_27_985.2
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G21490.1 | orthology | 1 | 10 | - | - |
| Ca_34_139.2 | orthology | 0 | 1 | - | - |
| Cc03_g02440 | orthology | 0.193 | 2 | - | - |
| Cg9g003840.1 | orthology | 1 | 9 | - | - |
| Cm135610.1 | orthology | 1 | 9 | - | - |
| Cs9g05250.1 | orthology | 1 | 8 | - | - |
| DCAR_030575 | orthology | 1 | 3 | - | - |
| FvH4_3g29750.1 | orthology | 1 | 8 | - | - |
| FvH4_4g16960.1 | orthology | 1 | 8 | - | - |
| HanXRQChr08g0226491 | orthology | 1 | 5 | - | - |
| MELO3C021374.2.1 | orthology | 1 | 9 | - | - |
| Manes.15G018700.1 | orthology | 1 | 8 | - | - |
| Solyc03g098650.2.1 | orthology | 1 | 5 | - | - |
| brana_pan_p026722 | orthology | 1 | 12 | - | - |
| braol_pan_p034893 | orthology | 1 | 11 | - | - |
| braol_pan_p054032 | orthology | 1 | 10 | - | - |
| brarr_pan_p010495 | orthology | 1 | 12 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_04222.1 | orthology | 1 | 10 | - | - |
| cicar_pan_p022803 | orthology | 1 | 10 | - | - |
| cucsa_pan_p017292 | orthology | 1 | 9 | - | - |
| medtr_pan_p033077 | orthology | 1 | 10 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.003G099700.1 | orthology | 1 | 11 | - | - |
| soybn_pan_p008694 | orthology | 1 | 11 | - | - |
| soybn_pan_p032351 | orthology | 1 | 11 | - | - |
| thecc_pan_p001371 | orthology | 1 | 7 | - | - |
| vitvi_pan_p022438 | orthology | 1 | 5 | - | - |
| vitvi_pan_p032656 | orthology | 1 | 5 | - | - |