Gene Ca_28_123.1
| Sequence ID | Ca_28_123.1 add to my list | ||
|---|---|---|---|
| Species | Coffea arabica | ||
| Alias | No gene alias | ||
| Length | 160aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 160 amino acids
>Ca_28_123.1_COFAR MDVRKGYEEQSQNCMARYLPNCPTLNHVERGRIYEAEWKKENLNQDKDCFQINAGVDSFD VDMDQQKVTVVGYVDRRKVLKVVRRTGRKAEFWPFPYDSEYYPYAAQYLDESTYSSTYNY YMHGYNESMHGYFPDLPYSTLDDKFAYSFSEENVHACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Ca_28_123.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G56891.1 | orthology | 0.97 | 6 | - | - |
| Ca_31_155.3 | ultra-paralogy | 0.0461 | 0 | - | - |
| Ca_64_676.1 | ultra-paralogy | 0.0844 | 0 | - | - |
| Ca_78_1273.1 | ultra-paralogy | 0.0461 | 0 | - | - |
| Cc06_g21060 | orthology | 0.213 | 1 | - | - |
| Cg6g011520.1 | orthology | 0.577 | 9 | - | - |
| Cs6g10930.1 | orthology | 0.571 | 9 | - | - |
| DCAR_016949 | orthology | 0.573 | 3 | - | - |
| FvH4_2g26780.1 | orthology | 0.578 | 7 | - | - |
| MELO3C019416.2.1 | orthology | 0.656 | 9 | - | - |
| Manes.08G099200.1 | orthology | 0.525 | 5 | - | - |
| Oeu053981.1 | orthology | 0.494 | 4 | - | - |
| brana_pan_p032952 | orthology | 1 | 7 | - | - |
| brana_pan_p033418 | orthology | 1 | 8 | - | - |
| brana_pan_p049288 | orthology | 1 | 6 | - | - |
| braol_pan_p001934 | orthology | 1 | 7 | - | - |
| braol_pan_p038031 | orthology | 1 | 7 | - | - |
| brarr_pan_p006813 | orthology | 1 | 8 | - | - |
| brarr_pan_p018750 | orthology | 1 | 6 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_46944.1 | orthology | 0.714 | 11 | - | - |
| cucsa_pan_p011351 | orthology | 0.689 | 9 | - | - |
| ipotf_pan_p003030 | orthology | 0.653 | 5 | - | - |
| itb11g01700.t1 | orthology | 0.649 | 5 | - | - |
| maldo_pan_p024328 | orthology | 0.662 | 7 | - | - |
| maldo_pan_p038662 | orthology | 0.568 | 7 | - | - |
| medtr_pan_p030129 | orthology | 0.664 | 9 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.004G052700.1 | orthology | 0.712 | 10 | - | - |
| soybn_pan_p020075 | orthology | 0.73 | 11 | - | - |
| thecc_pan_p019791 | orthology | 0.53 | 8 | - | - |
| vitvi_pan_p003255 | orthology | 0.417 | 3 | - | - |