Gene Ca_36_543.1
| Sequence ID | Ca_36_543.1 add to my list |
|---|---|
| Species | Coffea arabica |
| Alias | No gene alias |
| Length | 110aa |
Length: 110 amino acids
>Ca_36_543.1_COFAR MGIGETGIYSIMVDYQEQKVTVWGICNKYAVLASIRNKRKGAYFWKPEDSTQLLALEKLQ TPPSSPQSDSCPNPKPTSASAPSLALVTKGLGRSLSWKTWKKVFIRSYSF
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP342521 | Unannotated cluster |
| 4 | GP077751 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.