Gene Ca_42_221.2


Sequence ID Ca_42_221.2  add to my list
Species Coffea arabica
Alias No gene alias
Length 162aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 162 amino acids

>Ca_42_221.2_COFAR
MTIVEMRVHMDCPGCESKIKKALRKLDGVDNVDVDMGMQKVTVTGYADQEKVLKTVRKTG
RLAELWPFPYNPEYHDFNYAYYSHYYRNPATNFSVNPENYFASEATVFTKHDKYSFSSYN
YEVHGYNGHDHGYYHKPPLSTVIDDRTRDMFSDENAHGCSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Ca_42_221.2



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_66_295.2 orthology 0 1 - -
Cc02_g14880 orthology 0.023 2 - -
Oeu043106.1 orthology 0.524 4 167.9 8e-42
PGSC0003DMP400018109 orthology 0.441 5 - -
Solyc02g076880.2.1 orthology 0.464 5 176.4 1.5e-44
capan_pan_p000797 orthology 0.449 4 - -
ipotf_pan_p011098 orthology 0.453 6 - -
itb10g02670.t1 orthology 0.427 6 - -