Gene Ca_455_758.1
| Sequence ID | Ca_455_758.1 add to my list | ||
|---|---|---|---|
| Species | Coffea arabica | ||
| Alias | No gene alias | ||
| Length | 139aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 139 amino acids
>Ca_455_758.1_COFAR MGKLSFGRVLDRFCLSSSRSGSCLCINNYASEDERELESKPLITTPETGQLVKIKDVISA PPTLALQLKPQTVVLKVSMHCNGCARKVKKHISKMEGVTSYEVDLETKMVVVIGDIAPFE VLESVSKVKNAELWATPAC
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Ca_455_758.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_17_231.1 | orthology | 0 | 1 | - | - |
| Ca_34_152.1 | orthology | 0 | 1 | - | - |
| Cc06_g09440 | orthology | 0 | 1 | - | - |
| Oeu000379.1 | orthology | 0.456 | 2 | - | - |