Gene Ca_51_306.2
| Sequence ID | Ca_51_306.2 add to my list | ||
|---|---|---|---|
| Species | Coffea arabica | ||
| Alias | No gene alias | ||
| Length | 189aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 189 amino acids
>Ca_51_306.2_COFAR MVNLPERLFGFVVSALAYCFFQYHRHQDSNHYRPKSSNNDNISYKMPKTKARPLSLQTVE LKVRMCCSGCERVVKDAIHKLRGVDSVDVELEMDKVTVIGYVDRNKVLTAVRRAGKRAEF WPYPNPPLYFTSTTNYFKDTTSDFKESYNYWRHGYNAADRHGSLPVTQRGDDKVSNMFND DNVNACCLM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Ca_51_306.2
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cc08_g17060 | orthology | 0.0228 | 1 | 288.1 | 3.6e-78 |
| PGSC0003DMP400008918 | orthology | 0.347 | 3 | - | - |
| capan_pan_p004350 | orthology | 0.304 | 3 | - | - |