Gene Ca_64_447.2
Sequence ID | Ca_64_447.2 add to my list | ||
---|---|---|---|
Species | Coffea arabica | ||
Alias | No gene alias | ||
Length | 227aa | ||
Gene Ontology |
![]()
|
Length: 227 amino acids
>Ca_64_447.2_COFAR MSKEEKKEKEKVKVKEKEIEVITAVYKINLHCPKCAHDIRRPLLRIPGVHSADIKHEKNE VTIKGAIVAKKMHERLQKWSKKKVELISETKVKEAEKGAKETKKETIKTILIKSYMHCAE CEREIRKRLLKHKGIHNVKTDIKAQTISIEGVIESEKLLTYMRKKVHKYAEIIPPKAKEK EKEKKDEKKEKEKIEVKIVEFKEVEKVAAKTKEGDTPYFVHYVYAPQ
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP342504 | Unannotated cluster |
4 | GP464372 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Ca_64_447.2
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cc02_g26130 | orthology | 0.0011 | 1 | 347.4 | 6e-96 |
DCAR_029550 | orthology | 0.517 | 4 | 234.2 | 9.2e-62 |
HanXRQChr06g0168381 | orthology | 0.596 | 5 | 176.8 | 2.5e-44 |
Oeu036922.1 | orthology | 0.28 | 2 | - | - |
PGSC0003DMP400011529 | orthology | 0.507 | 6 | 196.4 | 2e-50 |
Solyc10g039390.1.1 | orthology | 0.56 | 6 | 208.8 | 3.9e-54 |
capan_pan_p023451 | orthology | 0.534 | 5 | 129 | 1.78e-38 |
ipotf_pan_p011107 | orthology | 0.466 | 5 | 214 | 2.82e-70 |
itb09g19040.t1 | orthology | 0.489 | 5 | 119.4 | 3.4e-27 |