Gene Ca_64_676.1


Sequence ID Ca_64_676.1  add to my list
Species Coffea arabica
Alias No gene alias
Length 114aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 114 amino acids

>Ca_64_676.1_COFAR
KDYFQINAGVDSFDVDMDKQKVTVVGYVDRRKVLKVVRRTGRKAEFWPFPYDSEYYPYAA
EYLDESTYSSTYNYYMHGYNESMHGYFPDLPYSTLDDKFAYSFSEENVHACSIM





Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323
Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397
Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121
Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163
Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Ca_64_676.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT3G56891.1 orthology 0.886 6 - -
Ca_28_123.1 ultra-paralogy 0.0844 0 - -
Ca_31_155.3 ultra-paralogy 0.0405 0 - -
Ca_78_1273.1 ultra-paralogy 0.0405 0 - -
Cc06_g21060 orthology 0.13 1 134.8 3.1e-32
Cg6g011520.1 orthology 0.494 9 - -
Cs6g10930.1 orthology 0.487 9 - -
DCAR_016949 orthology 0.49 3 99.4 1.8e-21
FvH4_2g26780.1 orthology 0.494 7 114 1.1e-33
MELO3C019416.2.1 orthology 0.573 9 - -
Manes.08G099200.1 orthology 0.441 5 - -
Oeu053981.1 orthology 0.41 4 112.8 2.2e-25
brana_pan_p032952 orthology 1 7 - -
brana_pan_p033418 orthology 1 8 - -
brana_pan_p049288 orthology 1 6 - -
braol_pan_p001934 orthology 1 7 - -
braol_pan_p038031 orthology 0.982 7 - -
brarr_pan_p006813 orthology 1 8 - -
brarr_pan_p018750 orthology 1 6 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_46944.1 orthology 0.63 11 - -
cucsa_pan_p011351 orthology 0.606 9 - -
ipotf_pan_p003030 orthology 0.57 5 - -
itb11g01700.t1 orthology 0.566 5 - -
maldo_pan_p024328 orthology 0.579 7 108 1.46e-31
maldo_pan_p038662 orthology 0.485 7 - -
medtr_pan_p030129 orthology 0.581 9 106 3.41e-31
phavu.G19833.gnm2.ann1.Phvul.004G052700.1 orthology 0.628 10 - -
soybn_pan_p020075 orthology 0.647 11 - -
thecc_pan_p019791 orthology 0.447 8 - -
vitvi_pan_p003255 orthology 0.334 3 - -