Gene Ca_89_554.1
| Sequence ID | Ca_89_554.1 add to my list | ||
|---|---|---|---|
| Species | Coffea arabica | ||
| Alias | No gene alias | ||
| Length | 155aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 155 amino acids
>Ca_89_554.1_COFAR MGVLDHLSDIFDCTSGGSSKLKKKKQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVQI EPKQHKLTVVGYVDPNKVVARVAHRTGKKAELWPYVPYDVVEHPYAPGVYDRKAPAGYVR SVEDPQLSQLARATSTEVRYTTAFSDENPSACIVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Ca_89_554.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_75_432.1 | orthology | 0 | 1 | - | - |
| DCAR_003170 | orthology | 0.208 | 3 | - | - |
| Oeu006689.1 | orthology | 0.199 | 3 | - | - |
| Oeu026682.1 | orthology | 0.19 | 3 | - | - |
| Oeu032526.1 | orthology | 0.189 | 3 | - | - |
| Oeu055667.1 | orthology | 0.318 | 3 | - | - |