Gene Ca_8_1007.1
Sequence ID | Ca_8_1007.1 add to my list | ||
---|---|---|---|
Species | Coffea arabica | ||
Alias | No gene alias | ||
Length | 138aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 138 amino acids
>Ca_8_1007.1_COFAR MSMVEVRVPNLDCEGCAAKTRKAIFKLKGVEEVDVEMETQKITVRGFGLEEKRVLKAIRR AGKAAEPWPYPAGYSYFASFYKYPSHVVNHYYDTTKNVAAPSVYSFFHTPAVYSVAVASD EAVASLFSDENPHACAIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Ca_8_1007.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT3G48970.1 | orthology | 0.514 | 9 | 198.7 | 2.3e-51 |
AUR62015981-RA | orthology | 0.467 | 8 | - | - |
Bv3_055490_mxet.t1 | orthology | 0.5 | 8 | 208 | 3.5e-54 |
Cc02_g02970 | orthology | 0.001 | 1 | 274.6 | 3e-74 |
Cg9g026790.1 | orthology | 0.314 | 9 | 215.7 | 1.7e-56 |
Cm028340.1 | orthology | 0.314 | 9 | 215.7 | 2.9e-56 |
Cs9g17280.1 | orthology | 0.314 | 9 | 215.7 | 1.9e-56 |
DCAR_009368 | orthology | 0.321 | 7 | 229.2 | 1.8e-60 |
FvH4_7g29520.1 | orthology | 0.354 | 10 | 214.5 | 4.1e-56 |
HanXRQChr06g0183831 | orthology | 0.391 | 4 | 209.9 | 1.6e-54 |
HanXRQChr09g0253621 | orthology | 0.418 | 4 | - | - |
MELO3C003319.2.1 | orthology | 0.45 | 8 | 183.7 | 6.7e-47 |
Manes.14G025900.1 | orthology | 0.387 | 10 | 225.3 | 2.6e-59 |
Mba01_g04690.1 | orthology | 0.57 | 7 | 186 | 1.7e-47 |
Oeu024220.1 | orthology | 0.217 | 4 | 234.2 | 7.8e-62 |
PGSC0003DMP400025270 | orthology | 0.213 | 5 | 243 | 1.1e-64 |
Solyc03g025790.2.1 | orthology | 0.203 | 5 | 242.7 | 1.5e-64 |
brana_pan_p044950 | orthology | 0.487 | 10 | 204 | 1.01e-68 |
braol_pan_p025375 | orthology | 0.487 | 11 | 204 | 4.85e-69 |
brarr_pan_p005835 | orthology | 0.487 | 11 | 204 | 4.32e-69 |
cajca.ICPL87119.gnm1.ann1.C.cajan_41314.1 | orthology | 0.363 | 11 | 219.9 | 1.1e-57 |
capan_pan_p012989 | orthology | 0.226 | 4 | 243 | 1.79e-84 |
cucsa_pan_p007884 | orthology | 0.417 | 8 | 191 | 1.96e-63 |
evm_27.model.AmTr_v1.0_scaffold00076.26 | orthology | 0.534 | 5 | 182.6 | 1.3e-46 |
ipotf_pan_p019855 | orthology | 0.225 | 4 | 235 | 2.79e-81 |
ipotf_pan_p021461 | orthology | 0.397 | 4 | - | - |
itb03g13280.t1 | orthology | 0.225 | 4 | 233.4 | 9.9e-62 |
itb12g25750.t1 | orthology | 0.384 | 4 | - | - |
maldo_pan_p005834 | orthology | 0.359 | 10 | 223 | 1.42e-76 |
maldo_pan_p046866 | orthology | 0.784 | 10 | - | - |
medtr_pan_p031372 | orthology | 0.346 | 9 | 217 | 4.62e-74 |
musac_pan_p029616 | orthology | 0.557 | 7 | 189 | 4.07e-63 |
phavu.G19833.gnm2.ann1.Phvul.004G116300.1 | orthology | 0.361 | 11 | 218.8 | 2.2e-57 |
soybn_pan_p030070 | orthology | 0.337 | 10 | 189 | 2.6e-63 |
thecc_pan_p002573 | orthology | 0.334 | 10 | 223 | 1.22e-76 |
vitvi_pan_p028565 | orthology | 0.28 | 5 | 220 | 2.24e-75 |