Gene Ca_9_475.1
| Sequence ID | Ca_9_475.1 add to my list | ||
|---|---|---|---|
| Species | Coffea arabica | ||
| Alias | No gene alias | ||
| Length | 175aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 175 amino acids
>Ca_9_475.1_COFAR MSMKAAKNMRGFMCQSPAATAVCMASEPLSVIVRRGPESDRTLAEHARLIDSTKHSRMVE PRARSRGLASATLRSAIVPSFGVENQPDKASRSQVVSSLAERDQVFQVVVMRVSLHCQGC AGKVKKHLSKMEGVTSFSIDLESKRVTVMGHVSPTGVVESISKVKRAELWPSAPC
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Ca_9_475.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cc02_g21770 | orthology | 0.0094 | 1 | - | - |
| Cg3g006140.1 | orthology | 0.687 | 8 | - | - |
| Cm169730.1 | orthology | 0.683 | 8 | - | - |
| Cm169730.2.1 | orthology | 0.683 | 8 | - | - |
| HanXRQChr11g0336891 | orthology | 0.649 | 3 | - | - |
| MELO3C018661.2.1 | orthology | 0.582 | 4 | - | - |
| Manes.06G009700.1 | orthology | 0.683 | 5 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_13580.1 | orthology | 0.865 | 3 | - | - |
| cucsa_pan_p000289 | orthology | 0.616 | 4 | - | - |
| orange1.1t02697.1 | orthology | 0.687 | 8 | - | - |
| thecc_pan_p016597 | orthology | 0.588 | 6 | - | - |