Gene Cc02_g09880


Sequence ID Cc02_g09880  add to my list
Species Coffea canephora
Alias No gene alias
Length 86aa
Gene Annotation homolog of anti-oxidant 1
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 86 amino acids

>Cc02_g09880_COFCA
MSQTVVLKVGMSCQGCVGAVNRVLSKMEGVESFDIDLKEQKVTVKGNVQPEAVLQTVSKT
GKKTSFWEEGASAAPESKPAETVAAA





Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323
Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121
Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163
Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Cc02_g09880



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
PGSC0003DMP400033854 orthology 0.298 3 129.8 8.9e-31
Solyc11g007200.1.1 orthology 0.299 3 131.3 3e-31
capan_pan_p004624 orthology 0.197 2 122 4.46e-38