Gene Cc02_g09880
| Sequence ID | Cc02_g09880 add to my list | ||
|---|---|---|---|
| Species | Coffea canephora | ||
| Alias | No gene alias | ||
| Length | 86aa | ||
| Gene Annotation | homolog of anti-oxidant 1 | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 86 amino acids
>Cc02_g09880_COFCA MSQTVVLKVGMSCQGCVGAVNRVLSKMEGVESFDIDLKEQKVTVKGNVQPEAVLQTVSKT GKKTSFWEEGASAAPESKPAETVAAA
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP239638 | Unannotated cluster |
| 3 | GP341755 | Unannotated cluster |
| 4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cc02_g09880
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| PGSC0003DMP400033854 | orthology | 0.298 | 3 | 129.8 | 8.9e-31 |
| Solyc11g007200.1.1 | orthology | 0.299 | 3 | 131.3 | 3e-31 |
| capan_pan_p004624 | orthology | 0.197 | 2 | 122 | 4.46e-38 |