Gene Cc05_g08310
| Sequence ID | Cc05_g08310 add to my list | ||
|---|---|---|---|
| Species | Coffea canephora | ||
| Alias | No gene alias | ||
| Length | 153aa | ||
| Gene Annotation | Heavy metal transport/detoxification superfamily protein | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 153 amino acids
>Cc05_g08310_COFCA MLVHMDCAGCVSKIRKALQNLKGVDNVEIDMSMQKVTVTGSVEQKKVLKTVRKTGRRAEL WQLPYNPVLRNHNYTVYNPHSYGGCGGPATYYATSQPPAASSYNYYKHGYDHSSQDYGYF SSYSSHQFGHSTIFGSRVGEVFSEESVHGCSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cc05_g08310
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Oeu042935.1 | orthology | 0.529 | 2 | 179.5 | 2.5e-45 |
| PGSC0003DMP400035470 | orthology | 0.647 | 5 | 119.8 | 1.6e-27 |
| Solyc07g055010.2.1 | orthology | 0.658 | 5 | 173.7 | 9.4e-44 |
| capan_pan_p019104 | orthology | 0.65 | 4 | 177 | 4.99e-58 |
| ipotf_pan_p020842 | orthology | 0.556 | 4 | 174 | 7.28e-57 |
| itb02g08570.t1 | orthology | 0.562 | 4 | 171.8 | 3.9e-43 |