Gene Cc06_g04230
Sequence ID | Cc06_g04230 add to my list | ||
---|---|---|---|
Species | Coffea canephora | ||
Alias | No gene alias | ||
Length | 356aa | ||
Gene Annotation | Putative Heavy metal transport/detoxification superfamily protein | ||
Gene Ontology |
Display term(s) (1)
|
Length: 356 amino acids
>Cc06_g04230_COFCA MGEKDEKKNEGEKKVTEAKNQGEKKTADGGGKKDDAQSPIVLKLDLHCEGCAKKVKRSIK HFDGVEDVKADCASNKLTVTGNVDPGWLREKVEQRTKKKVELLSPPSKKDSGGGGDKKAD DKADKKSDDKKKDEPKKPKEPQVSTVVLKIRLHCDGCAHKIKRIIKKIDGVEAVAVDNEK DLVTVKGTMDAKDLTPYLKDKLKRTVDVVPPKKDDGGGDKKEKEAGGGDKKEKEKQKESS GEKGAAESKGGAGGGGGDKGKSIEEPKVGVHKLEYHGASASTPYTYYYYGMPVYNQSYAN QDYGVSVPTMYGQGGYGTTGYVVDYRPHEPPPPPPVYLPAHDQMFSDENPNACSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP071484 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cc06_g04230
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_452_22.1 | orthology | 0.0136 | 1 | 450.3 | 3.1e-126 |
Ca_7_292.1 | orthology | 0.0136 | 1 | - | - |
DCAR_014996 | orthology | 0.623 | 5 | 186.4 | 3.5e-47 |
DCAR_017683 | orthology | 0.608 | 5 | - | - |
HanXRQChr01g0027741 | orthology | 0.751 | 5 | - | - |
HanXRQChr13g0401031 | orthology | 0.814 | 5 | - | - |
HanXRQChr14g0454431 | orthology | 0.69 | 5 | 198 | 1.6e-50 |
HanXRQChr17g0570331 | orthology | 0.677 | 5 | - | - |
Oeu005022.1 | orthology | 0.584 | 2 | - | - |
Oeu016984.1 | orthology | 0.556 | 2 | 190.7 | 2.5e-48 |
Oeu019283.1 | orthology | 0.518 | 2 | - | - |
Oeu045227.1 | orthology | 0.649 | 2 | - | - |
Oeu061953.1 | orthology | 0.583 | 2 | - | - |
PGSC0003DMP400006915 | orthology | 0.496 | 6 | 232.3 | 5.2e-61 |
Solyc09g008200.2.1 | orthology | 0.536 | 6 | 228 | 9.8e-60 |
Solyc10g086280.1.1 | orthology | 0.677 | 5 | - | - |
capan_pan_p000093 | orthology | 0.803 | 5 | - | - |
capan_pan_p021581 | orthology | 0.557 | 5 | 184 | 4.15e-56 |
ipotf_pan_p002813 | orthology | 0.649 | 5 | 259 | 1.44e-84 |
ipotf_pan_p014346 | orthology | 0.577 | 5 | - | - |
itb06g04100.t1 | orthology | 0.569 | 5 | 185.3 | 7.9e-47 |
itb15g00310.t1 | orthology | 0.654 | 5 | - | - |