Gene Cc06_g04230
| Sequence ID | Cc06_g04230 add to my list | ||
|---|---|---|---|
| Species | Coffea canephora | ||
| Alias | No gene alias | ||
| Length | 356aa | ||
| Gene Annotation | Putative Heavy metal transport/detoxification superfamily protein | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 356 amino acids
>Cc06_g04230_COFCA MGEKDEKKNEGEKKVTEAKNQGEKKTADGGGKKDDAQSPIVLKLDLHCEGCAKKVKRSIK HFDGVEDVKADCASNKLTVTGNVDPGWLREKVEQRTKKKVELLSPPSKKDSGGGGDKKAD DKADKKSDDKKKDEPKKPKEPQVSTVVLKIRLHCDGCAHKIKRIIKKIDGVEAVAVDNEK DLVTVKGTMDAKDLTPYLKDKLKRTVDVVPPKKDDGGGDKKEKEAGGGDKKEKEKQKESS GEKGAAESKGGAGGGGGDKGKSIEEPKVGVHKLEYHGASASTPYTYYYYGMPVYNQSYAN QDYGVSVPTMYGQGGYGTTGYVVDYRPHEPPPPPPVYLPAHDQMFSDENPNACSVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP071484 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cc06_g04230
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_452_22.1 | orthology | 0.0136 | 1 | 450.3 | 3.1e-126 |
| Ca_7_292.1 | orthology | 0.0136 | 1 | - | - |
| DCAR_014996 | orthology | 0.623 | 5 | 186.4 | 3.5e-47 |
| DCAR_017683 | orthology | 0.608 | 5 | - | - |
| HanXRQChr01g0027741 | orthology | 0.751 | 5 | - | - |
| HanXRQChr13g0401031 | orthology | 0.814 | 5 | - | - |
| HanXRQChr14g0454431 | orthology | 0.69 | 5 | 198 | 1.6e-50 |
| HanXRQChr17g0570331 | orthology | 0.677 | 5 | - | - |
| Oeu005022.1 | orthology | 0.584 | 2 | - | - |
| Oeu016984.1 | orthology | 0.556 | 2 | 190.7 | 2.5e-48 |
| Oeu019283.1 | orthology | 0.518 | 2 | - | - |
| Oeu045227.1 | orthology | 0.649 | 2 | - | - |
| Oeu061953.1 | orthology | 0.583 | 2 | - | - |
| PGSC0003DMP400006915 | orthology | 0.496 | 6 | 232.3 | 5.2e-61 |
| Solyc09g008200.2.1 | orthology | 0.536 | 6 | 228 | 9.8e-60 |
| Solyc10g086280.1.1 | orthology | 0.677 | 5 | - | - |
| capan_pan_p000093 | orthology | 0.803 | 5 | - | - |
| capan_pan_p021581 | orthology | 0.557 | 5 | 184 | 4.15e-56 |
| ipotf_pan_p002813 | orthology | 0.649 | 5 | 259 | 1.44e-84 |
| ipotf_pan_p014346 | orthology | 0.577 | 5 | - | - |
| itb06g04100.t1 | orthology | 0.569 | 5 | 185.3 | 7.9e-47 |
| itb15g00310.t1 | orthology | 0.654 | 5 | - | - |