Gene Cc07_g08240


Sequence ID Cc07_g08240  add to my list
Species Coffea canephora
Alias No gene alias
Length 147aa
Gene Annotation Putative Heavy metal-associated isoprenylated plant protein 26
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 147 amino acids

>Cc07_g08240_COFCA
MGALDYLSNFCTVTSTRRSKRKPMQTVEIKVKMDCDGCERRVKNAVKDMKGLKTLEVDRK
QSRVKVSGYVDPNKVLKRIKDTGKRAEFWPYVPHNLVFYPYVTGAYDKRAPAGFVRNVVQ
AAPPPNATEERITYLFSDDNPNACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Cc07_g08240



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_1_37.3 orthology 0 1 305.8 3.9e-83
Ca_25_217.3 orthology 0 1 - -
Ca_53_45.6 orthology 0 1 - -
Ca_74_24.3 orthology 0 1 - -
DCAR_025878 orthology 0.17 2 261.9 2.7e-70
HanXRQChr12g0375901 orthology 0.235 4 - -
HanXRQChr17g0543461 orthology 0.217 4 260.8 8.5e-70
Oeu030808.1 orthology 0.234 5 255.8 2.6e-68
Oeu041969.1 orthology 0.296 5 - -
PGSC0003DMP400053293 orthology 0.336 7 236.5 1.1e-62
Solyc02g091300.2.1 orthology 0.316 7 241.9 2.7e-64
capan_pan_p020935 orthology 0.311 6 238 4.75e-82