Gene Cc09_g00460
| Sequence ID | Cc09_g00460 add to my list | ||
|---|---|---|---|
| Species | Coffea canephora | ||
| Alias | No gene alias | ||
| Length | 197aa | ||
| Gene Annotation | Hypothetical protein | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 197 amino acids
>Cc09_g00460_COFCA MGLSELDDIGEEKKEKANKEEEKKQILGNKEDTSKKEEEGDKKEEKKEEEVQEIVLKVDM HCEACARKVTRALKGFQVYLFSRFNLFISRIFRYRSMCSVMVKLILFHRTFSTKFTFHRT FSTDCFSERCNHNTKLETQVSLNSINTTIKTTTLEIFKTDLIRISANMAGIDLHYNLVTF PGFHSVRKIKFKNQHNP
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cc09_g00460
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| vitvi_pan_p024066 | orthology | 1 | 1 | - | - |
| vitvi_pan_p027020 | orthology | 1 | 1 | - | - |
| vitvi_pan_p030487 | orthology | 1 | 1 | - | - |
| vitvi_pan_p031668 | orthology | 1 | 1 | - | - |
| vitvi_pan_p032728 | orthology | 1 | 1 | - | - |
| vitvi_pan_p034172 | orthology | 1 | 1 | - | - |