Gene Cc10_g00190
Sequence ID | Cc10_g00190 add to my list |
---|---|
Species | Coffea canephora |
Alias | No gene alias |
Length | 172aa |
Gene Annotation | Auxin efflux carrier family protein |
Length: 172 amino acids
>Cc10_g00190_COFCA MGLLDLFSAASIPVLKVLLVTALGSYLALDRVNILGEDARKHLNSIVFYVFNPAIVSSNL AKTITYDSMVKLWFMPFNILITFLVGSVLGWLVIQMTRAPRHLHGLVIGCCAAGNLGNML LIIIPAVCKEKGSPFGAPDVCHSYGMAYASLSMAVCLYQLFQFKGSRWEHDW
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Auxin efflux carrier family
GP000355 |
Auxin efflux carrier family |
2 | GP015273 | Unannotated cluster |
3 | GP040583 | Unannotated cluster |
4 | GP463693 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.