Gene Cc11_g17230


Sequence ID Cc11_g17230  add to my list
Species Coffea canephora
Alias No gene alias
Length 217aa
Gene Annotation Putative Heavy metal transport/detoxification superfamily protein
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 217 amino acids

>Cc11_g17230_COFCA
MSPEGNIVLQVYIHCPGCEETVVKSLRGYDGVEGIEVDSKNHIVIVKGEKADPTKVAKRL
GKKSGKYVKLISPIPPKDKKEEKKEEKREPKGVEVVLKVHLHCEGCAKDVKHCIHKMPGV
RTVEPNMEKNVVTVKGGIEPQKLVEFVKKRAGKHAEIEIVKLEKQKQSEDKKNGKECETE
KHCNKSGGKEWYANFCPELVYAPQLFSDENPNACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP342504 Unannotated cluster
4 GP464372 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Cc11_g17230



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_73_71.2 orthology 0.0191 1 373.6 2.2e-103
DCAR_003359 orthology 0.876 3 161.4 7.3e-40
HanXRQChr01g0027281 orthology 0.747 3 - -
HanXRQChr08g0209971 orthology 0.709 3 196.1 3.8e-50
Solyc05g009440.1.1 orthology 0.698 5 211.5 5.8e-55
capan_pan_p013590 orthology 0.753 5 160 4.19e-50
ipotf_pan_p016439 orthology 0.848 5 223 8.02e-74
itb13g20500.t1 orthology 0.882 5 190.3 1.5e-48