Gene Cg4g008380.1
| Sequence ID | Cg4g008380.1 add to my list | ||
|---|---|---|---|
| Species | Citrus maxima | ||
| Alias | No gene alias | ||
| Length | 136aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 136 amino acids
>Cg4g008380.1_CITMA MGKLSLGKILDCLCISSPGSCSCFCLNTLEGQDEFEKKPLMKSDGGQLLRLKDVVSGNQT LAFQLKPKMVVLRVSMHCNGCARKVEKHVSKLEGVTSYKVDLASKMVVVIGDIIPFEVLE SVSKVKNAELWSASCY
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cg4g008380.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G24450.1 | orthology | 0.617 | 4 | 161.4 | 4e-40 |
| Cm003330.1 | orthology | 0.0157 | 3 | 272.3 | 2.6e-73 |
| Cm280700.1 | orthology | 0.0157 | 3 | - | - |
| Cs4g16810.1 | orthology | 0.0157 | 2 | 272.3 | 1.7e-73 |
| brana_pan_p019259 | orthology | 0.653 | 6 | 160 | 1.58e-51 |
| braol_pan_p017790 | orthology | 0.653 | 6 | 160 | 1.44e-51 |
| brarr_pan_p009295 | orthology | 0.64 | 5 | 160 | 9.02e-52 |
| thecc_pan_p010057 | orthology | 0.198 | 3 | 212 | 1.77e-72 |