Gene Cg8g019570.1
Sequence ID | Cg8g019570.1 add to my list | ||
---|---|---|---|
Species | Citrus maxima | ||
Alias | No gene alias | ||
Length | 333aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 333 amino acids
>Cg8g019570.1_CITMA MGKKKKNNNSNNENDNKENDNNNGNNEAEKKKKEEEEGDAVAEKKKDDKKSSVTVILKVD MHCEGCANKIVRYARSFEGVEAVKAEVAANKITIVGAVDPSKIREKLDKKTKKKIDLISP QPKKDNKDKEPKQDNKPKDNKSPDDKKPKEPPVTTAVLKLVLHCQGCIEKILKIVSKTKG VMDKSIDKQKDTVTVKGTMDAKALAEVLKERLKRPVEIVPPKKEKEKEKNDEKESNGGDN NNSGNGGSKKKKGGGGGGGGGGGQEVGDGGGGGGKMEESRMEYFPMGVPGSGYGHGYQIH GGYEYGYPVGGYYHQPAAPQMFSDENPNACVVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP071484 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cg8g019570.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT2G28090.1 | orthology | 1 | 7 | - | - |
Cm049010.1 | orthology | 0.0054 | 2 | - | - |
Cs8g15890.1 | orthology | 0.0091 | 2 | 191.8 | 7.1e-49 |
DCAR_015174 | orthology | 1 | 6 | - | - |
Manes.04G015400.1 | orthology | 0.632 | 2 | 202 | 1.49e-62 |
Manes.11G150800.1 | orthology | 0.644 | 2 | - | - |
Manes.11G150900.1 | orthology | 0.67 | 2 | 173.3 | 2.9e-43 |
brana_pan_p035445 | orthology | 1 | 8 | - | - |
brana_pan_p036106 | orthology | 1 | 8 | - | - |
braol_pan_p002645 | orthology | 1 | 8 | - | - |
braol_pan_p042787 | orthology | 1 | 8 | - | - |
brarr_pan_p026563 | orthology | 1 | 8 | - | - |
thecc_pan_p013140 | orthology | 0.706 | 5 | 180 | 1.95e-54 |
vitvi_pan_p000499 | orthology | 0.722 | 3 | 188 | 1.33e-57 |