Gene Cg8g019570.1


Sequence ID Cg8g019570.1  add to my list
Species Citrus maxima
Alias No gene alias
Length 333aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 333 amino acids

>Cg8g019570.1_CITMA
MGKKKKNNNSNNENDNKENDNNNGNNEAEKKKKEEEEGDAVAEKKKDDKKSSVTVILKVD
MHCEGCANKIVRYARSFEGVEAVKAEVAANKITIVGAVDPSKIREKLDKKTKKKIDLISP
QPKKDNKDKEPKQDNKPKDNKSPDDKKPKEPPVTTAVLKLVLHCQGCIEKILKIVSKTKG
VMDKSIDKQKDTVTVKGTMDAKALAEVLKERLKRPVEIVPPKKEKEKEKNDEKESNGGDN
NNSGNGGSKKKKGGGGGGGGGGGQEVGDGGGGGGKMEESRMEYFPMGVPGSGYGHGYQIH
GGYEYGYPVGGYYHQPAAPQMFSDENPNACVVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP040674 Unannotated cluster
4 GP071484 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Cg8g019570.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT2G28090.1 orthology 1 7 - -
Cm049010.1 orthology 0.0054 2 - -
Cs8g15890.1 orthology 0.0091 2 191.8 7.1e-49
DCAR_015174 orthology 1 6 - -
Manes.04G015400.1 orthology 0.632 2 202 1.49e-62
Manes.11G150800.1 orthology 0.644 2 - -
Manes.11G150900.1 orthology 0.67 2 173.3 2.9e-43
brana_pan_p035445 orthology 1 8 - -
brana_pan_p036106 orthology 1 8 - -
braol_pan_p002645 orthology 1 8 - -
braol_pan_p042787 orthology 1 8 - -
brarr_pan_p026563 orthology 1 8 - -
thecc_pan_p013140 orthology 0.706 5 180 1.95e-54
vitvi_pan_p000499 orthology 0.722 3 188 1.33e-57