Gene Cg9g002000.1
| Sequence ID | Cg9g002000.1 add to my list | ||
|---|---|---|---|
| Species | Citrus maxima | ||
| Alias | No gene alias | ||
| Length | 335aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 335 amino acids
>Cg9g002000.1_CITMA MAPELEKPRVTEIQVRMDCNGCVQKIKKALHGINGIYDLHIDFPQQKLTIVGWADPERIV KAIRKTRKIATICSHSEQTEPSNQPTEQALPEDGAPASNDAPANPPPPEGPPAEQPQPAE PPKDPPPTENPAPPENPPPLEDPQPKVKPSPIAADANANQQACPSRAKDIGEVHVIHHHP PDYGYRYSYGYGNNYSGHWNRYPSVARNQHEAPQGPQPVYNQHEAPQGPQPVYNQHGEPQ GPQPVYNQHGAPQGPQPVYVTHSYNTYKPSPYVTEYEYLRSPPRHTHYSRMDHYSDDYHN NYHNNNVYYNTSNGSGNGNITSIFSDENPNTCTVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP047778 | Unannotated cluster |
| 4 | GP077656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cg9g002000.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cm229420.1 | orthology | 0.0125 | 1 | 298.9 | 6.4e-81 |
| FvH4_4g18950.1 | orthology | 0.561 | 5 | 154.5 | 1.2e-37 |
| Manes.15G008800.1 | orthology | 0.411 | 2 | 198.7 | 6.4e-51 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_04327.1 | orthology | 0.836 | 6 | 123.6 | 2.6e-28 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_31773.1 | orthology | 0.697 | 7 | 197 | 5.53e-62 |
| cicar_pan_p002360 | orthology | 0.912 | 7 | 122 | 7.87e-33 |
| maldo_pan_p004517 | orthology | 0.571 | 5 | 263 | 6.07e-86 |
| maldo_pan_p022412 | orthology | 0.59 | 5 | - | - |
| medtr_pan_p024125 | orthology | 0.936 | 7 | 108 | 7.18e-28 |
| phavu.G19833.gnm2.ann1.Phvul.003G108900.1 | orthology | 0.91 | 7 | 122.5 | 5.2e-28 |
| soybn_pan_p005812 | orthology | 0.834 | 6 | - | - |
| soybn_pan_p009634 | orthology | 0.868 | 7 | - | - |
| soybn_pan_p012740 | orthology | 0.668 | 7 | 170 | 4.24e-51 |
| thecc_pan_p016610 | orthology | 0.438 | 3 | 249 | 8.85e-81 |
| vitvi_pan_p020280 | orthology | 0.424 | 5 | 247 | 1.2e-80 |