Gene CgUng002500.1


Sequence ID CgUng002500.1  add to my list
Species Citrus maxima
Alias No gene alias
Length 318aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 318 amino acids

>CgUng002500.1_CITMA
MGEQNEGDKKAAGAAADAGGKKDDGVVTVVLKVDLHCEGCAKKIKRAMKNYEGVVDVKTD
CGANKVTVTGKVEPAKLKERLEAKTKKKVDLVSPQPKKDAGGGEKKSEEKSEKKPDDKKS
EDKKPPKESTVVLKIRLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGTMDVKELV
PYLKEKLKRNVEVVPAKKDDGEKKENKDADKGGDKKAKEAAPAADKGGEKKEKEAAAAGG
GDGGKVEVHKMEYYGYPYPPAPSYWYDNHVYGQSYPMENQHQVVYVNQGYPPQMHHAPPL
YHAPQMFSDENPNACSVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP040674 Unannotated cluster
4 GP071484 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for CgUng002500.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
CgUng019980.1 orthology 0 1 - -
Cm060230.1 orthology 0.0141 3 446 3.1e-125
FvH4_6g16410.1 orthology 0.567 7 201.4 8.2e-52
MELO3C024466.2.1 orthology 0.536 7 - -
Manes.08G010600.1 orthology 0.378 4 218 9.7e-57
Manes.09G066300.1 orthology 0.405 4 - -
cucsa_pan_p001888 orthology 0.547 7 199 1.41e-61
maldo_pan_p018618 orthology 0.533 7 247 8.1e-80
maldo_pan_p021518 orthology 0.547 7 - -
orange1.1t00956.1 orthology 0.0137 2 439.5 1.9e-123