Gene CgUng002500.1
Sequence ID | CgUng002500.1 add to my list | ||
---|---|---|---|
Species | Citrus maxima | ||
Alias | No gene alias | ||
Length | 318aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 318 amino acids
>CgUng002500.1_CITMA MGEQNEGDKKAAGAAADAGGKKDDGVVTVVLKVDLHCEGCAKKIKRAMKNYEGVVDVKTD CGANKVTVTGKVEPAKLKERLEAKTKKKVDLVSPQPKKDAGGGEKKSEEKSEKKPDDKKS EDKKPPKESTVVLKIRLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGTMDVKELV PYLKEKLKRNVEVVPAKKDDGEKKENKDADKGGDKKAKEAAPAADKGGEKKEKEAAAAGG GDGGKVEVHKMEYYGYPYPPAPSYWYDNHVYGQSYPMENQHQVVYVNQGYPPQMHHAPPL YHAPQMFSDENPNACSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP071484 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for CgUng002500.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
CgUng019980.1 | orthology | 0 | 1 | - | - |
Cm060230.1 | orthology | 0.0141 | 3 | 446 | 3.1e-125 |
FvH4_6g16410.1 | orthology | 0.567 | 7 | 201.4 | 8.2e-52 |
MELO3C024466.2.1 | orthology | 0.536 | 7 | - | - |
Manes.08G010600.1 | orthology | 0.378 | 4 | 218 | 9.7e-57 |
Manes.09G066300.1 | orthology | 0.405 | 4 | - | - |
cucsa_pan_p001888 | orthology | 0.547 | 7 | 199 | 1.41e-61 |
maldo_pan_p018618 | orthology | 0.533 | 7 | 247 | 8.1e-80 |
maldo_pan_p021518 | orthology | 0.547 | 7 | - | - |
orange1.1t00956.1 | orthology | 0.0137 | 2 | 439.5 | 1.9e-123 |