Gene Cm053240.1


Sequence ID Cm053240.1  add to my list
Species Citrus medica
Alias No gene alias
Length 115aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 115 amino acids

>Cm053240.1_CITME
MDCDGCERRVRHAVSSMKGAKSVEVNRKQSRVTVTGHVDPNKVLKKVKSTGKRAEFWPYV
PYNLVAYPYVAQAYDKKAPSGYVRNVAQALPSPNAADEKLVSLFSDENPNACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Cm053240.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cg2g033960.1 orthology 0.0011 1 235.7 1.4e-62
Cs2g13800.1 orthology 0.0102 2 234.6 3.3e-62
MELO3C005315.2.1 orthology 0.662 6 - -
MELO3C012307.2.1 orthology 0.602 6 - -
Manes.15G126400.1 orthology 0.387 4 - -
Manes.17G075300.1 orthology 0.441 4 - -
cucsa_pan_p007548 orthology 0.655 6 - -
cucsa_pan_p020835 orthology 0.609 6 - -
thecc_pan_p004875 orthology 0.353 3 - -