Gene Cm053240.1
Sequence ID | Cm053240.1 add to my list | ||
---|---|---|---|
Species | Citrus medica | ||
Alias | No gene alias | ||
Length | 115aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 115 amino acids
>Cm053240.1_CITME MDCDGCERRVRHAVSSMKGAKSVEVNRKQSRVTVTGHVDPNKVLKKVKSTGKRAEFWPYV PYNLVAYPYVAQAYDKKAPSGYVRNVAQALPSPNAADEKLVSLFSDENPNACSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cm053240.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg2g033960.1 | orthology | 0.0011 | 1 | 235.7 | 1.4e-62 |
Cs2g13800.1 | orthology | 0.0102 | 2 | 234.6 | 3.3e-62 |
MELO3C005315.2.1 | orthology | 0.662 | 6 | - | - |
MELO3C012307.2.1 | orthology | 0.602 | 6 | - | - |
Manes.15G126400.1 | orthology | 0.387 | 4 | - | - |
Manes.17G075300.1 | orthology | 0.441 | 4 | - | - |
cucsa_pan_p007548 | orthology | 0.655 | 6 | - | - |
cucsa_pan_p020835 | orthology | 0.609 | 6 | - | - |
thecc_pan_p004875 | orthology | 0.353 | 3 | - | - |