Gene Cm121490.1


Sequence ID Cm121490.1  add to my list
Species Citrus medica
Alias No gene alias
Length 88aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 88 amino acids

>Cm121490.1_CITME
MSQTVVLKVDMSCEGCYGAVKRVLGKMDGVETFDIDLKEQKVTVKGNVQPDAVLQTVSKA
GKKTAFWEEEKPAPAESDSKPTEAVAAA




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Cm121490.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HanXRQChr07g0194221 orthology 0.761 1 - -
HanXRQChr08g0217841 orthology 0.371 1 - -
HanXRQChr11g0322281 orthology 0.664 1 - -
HanXRQChr12g0368131 orthology 0.371 1 - -
PGSC0003DMP400040663 orthology 0.266 4 - -
Solyc05g055310.2.1 orthology 0.266 4 - -
capan_pan_p024732 orthology 0.324 3 - -