Gene Cm229420.1
| Sequence ID | Cm229420.1 add to my list | ||
|---|---|---|---|
| Species | Citrus medica | ||
| Alias | No gene alias | ||
| Length | 349aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 349 amino acids
>Cm229420.1_CITME MAPELEKPRVTEIQVRMDCNGCVQKIKKALHGINGIYDLHIDFPQQKLTIVGWADPERIV KAIRKTRKIATICSHSEQTEPSNQPTEQALPEDGAPAPSNDPPANPPPPEGPPAEQPQPA EPPKDPPPTENPAPPENPPPLEDPQPEVKPSPIAADANANQQACPSRAKDIGEVHVIHHH PPDYGYRYSYGYGNNYSGHWNRYLSVARNQHEAPQGPQPVYNQHEAPQGPQLVYNQHGEP QGSQPVYNQHGEPQGPQPVYNQHGAPQGPQPVYVTHSYNTYKPSPYVTEYEYLRSPPRHT HYSRMDRYSDDYHNNYHNNNVYYNTSNGSGNGNITSIFSDENPNACTVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP047778 | Unannotated cluster |
| 4 | GP077656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cm229420.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cg9g002000.1 | orthology | 0.0125 | 1 | 300.1 | 1.8e-81 |
| FvH4_4g18950.1 | orthology | 0.564 | 5 | 154.1 | 1.6e-37 |
| Manes.15G008800.1 | orthology | 0.413 | 2 | 196.4 | 3.3e-50 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_04327.1 | orthology | 0.839 | 6 | 123.2 | 3.5e-28 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_31773.1 | orthology | 0.7 | 7 | 192 | 1.05e-59 |
| cicar_pan_p002360 | orthology | 0.915 | 7 | 122 | 1.06e-32 |
| maldo_pan_p004517 | orthology | 0.574 | 5 | 272 | 3.38e-89 |
| maldo_pan_p022412 | orthology | 0.592 | 5 | - | - |
| medtr_pan_p024125 | orthology | 0.938 | 7 | 135 | 9.27e-38 |
| phavu.G19833.gnm2.ann1.Phvul.003G108900.1 | orthology | 0.913 | 7 | 119.8 | 3.5e-27 |
| soybn_pan_p005812 | orthology | 0.836 | 6 | - | - |
| soybn_pan_p009634 | orthology | 0.87 | 7 | - | - |
| soybn_pan_p012740 | orthology | 0.671 | 7 | 165 | 5.35e-49 |
| thecc_pan_p016610 | orthology | 0.441 | 3 | 244 | 1.78e-78 |
| vitvi_pan_p020280 | orthology | 0.426 | 5 | 249 | 3.38e-81 |