Gene Cm280700.3
Sequence ID | Cm280700.3 add to my list | ||
---|---|---|---|
Species | Citrus medica | ||
Alias | No gene alias | ||
Length | 136aa | ||
Gene Ontology |
![]()
|
Length: 136 amino acids
>Cm280700.3_CITME MGKLSLGKILDCLCISSPGSCSCFCLNTFEGQDEFEKKPLMKSDGGQLLRLKDVVSGNQT LAFQLKPKMVVLRVSMHCNGCARKVEKHVSKLEGVTSYKVDLASKMVVVTGDIIPFEVLE SVSKVKNAELWSASCY
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.