Gene Cm308920.1
| Sequence ID | Cm308920.1 add to my list |
|---|---|
| Species | Citrus medica |
| Alias | No gene alias |
| Length | 110aa |
Length: 110 amino acids
>Cm308920.1_CITME MYGPHGPTHAPFSFPASYSPPRQHGYPYAQYAPPPHYYTPPVYAMSYNTAHPRPSYTTSY YAAPTPNSYAYMHPGTGSEIPPSDVDSYSSQPSDSFEIFSDENPNACAIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cm091290.1 | ultra-paralogy | 0.001 | 0 | - | - |
| Cs3g14250.1 | orthology | 0.0643 | 1 | - | - |
| thecc_pan_p002960 | orthology | 0.363 | 2 | - | - |