Gene Cs5g32830.1
Sequence ID | Cs5g32830.1 add to my list | ||
---|---|---|---|
Species | Citrus sinensis | ||
Alias | No gene alias | ||
Length | 286aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 286 amino acids
>Cs5g32830.1_CITSI MAAKVADDQPPHPHPLQFQTWVLKVLIHCEGCKKKVTKILKGIEGVYTAVIDSQQHKVTV IGNVDAETLIKKLLRSGKHAELWPEKKDKTSGKSKNNDKQKELSKDGQEVLDDRHKDTAE KPDEKSGDNPPGTGIEGQGGNGSGGKKKKKKKGNSSGTGGSGENVGNEPAAGITGSPAVA AAVDPIPSEVAPIPRHQQQYPSPPFMQQEHPPMYYPPHPAPLHGVSYNTTYPTASTSYYA PSMHAYYNSSYHRPGRYIPPDPIHKFTEDDHGYYDNDEGTAGCSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cs5g32830.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg5g037020.1 | orthology | 0.0121 | 2 | 494.6 | 4e-140 |
Cm177940.1 | orthology | 0.0178 | 1 | 483.8 | 1.2e-136 |
FvH4_2g25240.1 | orthology | 1 | 8 | 111.7 | 7.7e-25 |
FvH4_3g05420.1 | orthology | 1 | 8 | - | - |
Manes.01G216400.1 | orthology | 0.937 | 6 | 153.7 | 2e-37 |
Manes.05G064600.1 | orthology | 1 | 6 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_10299.1 | orthology | 0.964 | 5 | 120.6 | 1.9e-27 |
cicar_pan_p013771 | orthology | 0.999 | 5 | 120 | 4.01e-32 |
maldo_pan_p006711 | orthology | 1 | 8 | 125 | 1.95e-33 |
maldo_pan_p033280 | orthology | 0.976 | 8 | - | - |
medtr_pan_p025269 | orthology | 1 | 5 | 140 | 1.46e-39 |
phavu.G19833.gnm2.ann1.Phvul.001G205300.1 | orthology | 1 | 6 | 120.9 | 1.3e-27 |
soybn_pan_p005697 | orthology | 0.969 | 6 | - | - |
soybn_pan_p010098 | orthology | 0.994 | 6 | 121 | 3.77e-32 |
thecc_pan_p017549 | orthology | 0.54 | 3 | 155 | 2.29e-45 |
vitvi_pan_p002541 | orthology | 0.932 | 7 | 140 | 3.77e-40 |