Gene Cs6g10930.1


Sequence ID Cs6g10930.1  add to my list
Species Citrus sinensis
Alias No gene alias
Length 156aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 156 amino acids

>Cs6g10930.1_CITSI
MFGWRLGKTQLPNAMAIVELMVHMDCEGCEKRIRRAISKIDGIFDFIITGVDSLDIDMDK
QKVTVTGYVDERKVLKVVRRTGRKAEFWPFPYDSEYYPYASTYLDESTFRSSYNYYQHGF
NESVHGYFPDQAYETVPDDTVHLFSEDNVHAYCTIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Cs6g10930.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT3G56891.1 orthology 0.752 8 160.2 1e-39
Ca_28_123.1 orthology 0.571 9 - -
Ca_31_155.3 orthology 0.527 9 - -
Ca_64_676.1 orthology 0.487 9 - -
Ca_78_1273.1 orthology 0.527 9 - -
Cc06_g21060 orthology 0.442 9 122.5 2.2e-28
Cg6g011520.1 orthology 0.0072 1 304.7 3.2e-83
DCAR_016949 orthology 0.588 9 140 5.9e-44
FvH4_2g26780.1 orthology 0.258 5 196.1 1.7e-50
MELO3C019416.2.1 orthology 0.302 5 173.7 7.8e-44
Manes.08G099200.1 orthology 0.25 5 189.9 1.4e-48
Oeu053981.1 orthology 0.508 10 165.2 5e-41
brana_pan_p032952 orthology 0.9 9 - -
brana_pan_p033418 orthology 0.871 10 150 5.24e-47
brana_pan_p049288 orthology 0.899 8 - -
braol_pan_p001934 orthology 0.905 9 149 9.86e-47
braol_pan_p038031 orthology 0.848 9 - -
brarr_pan_p006813 orthology 0.871 10 - -
brarr_pan_p018750 orthology 0.904 8 149 8.52e-47
cajca.ICPL87119.gnm1.ann1.C.cajan_46944.1 orthology 0.294 5 196.4 1.5e-50
cucsa_pan_p011351 orthology 0.335 5 230 5.41e-79
ipotf_pan_p003030 orthology 0.668 11 187 8.08e-62
itb11g01700.t1 orthology 0.664 11 187.2 9.2e-48
maldo_pan_p024328 orthology 0.342 5 - -
maldo_pan_p038662 orthology 0.248 5 191 2.66e-63
medtr_pan_p030129 orthology 0.245 3 190 1.15e-63
phavu.G19833.gnm2.ann1.Phvul.004G052700.1 orthology 0.292 4 238 4e-63
soybn_pan_p020075 orthology 0.311 5 190 2.29e-63
thecc_pan_p019791 orthology 0.176 4 206 2.49e-69
vitvi_pan_p003255 orthology 0.299 7 171 1.44e-55